PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0016s0340.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 394aa    MW: 44102.5 Da    PI: 6.05
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0016s0340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.4e-52211481128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL+ kv + ++     i+evd++++ePw+Lp  +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatg
  SapurV1A.0016s0340.1.p  21 LPPGFRFHPTDEELITFYLASKVFSGSFCG-VDIAEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATG 106
                             79*************************877.34***************8888899******************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kd+ev+s+ +g+  glkktLvfykgrap+gekt+Wvmheyrl
  SapurV1A.0016s0340.1.p 107 KDREVYSAsTGAMLGLKKTLVFYKGRAPRGEKTKWVMHEYRL 148
                             ******9878888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-6316170IPR003441NAC domain
PROSITE profilePS5100559.58521170IPR003441NAC domain
PfamPF023653.3E-2722148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MLAMEELLCE LTCEEINDQG LPPGFRFHPT DEELITFYLA SKVFSGSFCG VDIAEVDLNR  60
CEPWELPDVA KMGEREWYFF SLRDRKYPTG LRTNRATGAG YWKATGKDRE VYSASTGAML  120
GLKKTLVFYK GRAPRGEKTK WVMHEYRLDG DFSFRHSCKE EWVICRIFHK KGEKKNVFLQ  180
AEQGYHHLME ASSPANSGSL PPLLEPSAPI FDQCQSKNTV DEAFQNAFLI HEHQENDLRS  240
LLNPLVSQSN AMPINGFQPC FSPTTSTNKN TGTNSNSQSP SMLFKSSFSY QDSKQSGTNY  300
KQCSTEANFS HFQFPDAHLG CVDKIVHPNP HQNNPSFFEM GCGGNILGFS ESASAADTIA  360
HDMSTSIGFS RAGLQMMLDT PIRLPGESWP FDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-512117117166NO APICAL MERISTEM PROTEIN
1ut4_B2e-512117117166NO APICAL MERISTEM PROTEIN
1ut7_A2e-512117117166NO APICAL MERISTEM PROTEIN
1ut7_B2e-512117117166NO APICAL MERISTEM PROTEIN
4dul_A2e-512117117166NAC domain-containing protein 19
4dul_B2e-512117117166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300627.10.0hypothetical protein POPTR_0002s00730g
SwissprotQ9S8511e-109NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLB9GPP50.0B9GPP5_POPTR; Uncharacterized protein
STRINGPOPTR_0002s00730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78883347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-104NAC family protein